Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (N501Y), partial (Active)

• Product Name Alternative:

  /

• Abbreviation:

  Recombinant SARS-CoV-2 S protein (N501Y), partial (Active)

• Gene Name:

  S

• UniProt:

  P0DTC2

• Expression Region:

  319-541aa (N501Y)

• Organism:

  Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

• Target Sequence:

  RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

• Tag:

  C-terminal 6xHis-mFC-tagged

• Type:

  Active Protein & In Stock Protein & Coronavirus Protein

• Source:

  Mammalian cell

• Field of Research:

  Microbiology

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (N501Y) at 2 μg/ml can bind human ACE2 (CSB-MP866317HU-B), the EC50 is 2.492-4.401 ng/ml.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  55.3 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial