Recombinant Human parainfluenza 1 virus Nucleoprotein (N)

CAT:
399-GTR13816185
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human parainfluenza 1 virus Nucleoprotein (N)

  • Product Name Alternative:

    Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)

  • Abbreviation:

    Recombinant Human parainfluenza 1 virus N protein

  • Gene Name:

    N

  • UniProt:

    P24304

  • Expression Region:

    1-524aa

  • Organism:

    Human parainfluenza 1 virus (strain C39) (HPIV-1)

  • Target Sequence:

    MAGLLSTFDTFSSRRSESINKSGGGAIIPGQRSTVSVFILGPSVTDDADKLLIATTFLAHSLDTDKQHSQRGGFLVSLLAMAYSSPELYLTTNGVNADVKYVIYNIERDPKRTKTDGFIVKTRDMEYERTTEWLFGPMINKNPLFQGQRENADLEALLQTYGYPACLGAIIVQVWIVLVKAITSSSGLRKGFFNRLEAFRQDGTVKSALVFTGDTVEGIGAVMRSQQSLVSLMVETLVTMNTSRSDLTTLEKNIQIVGNYIRESGLASFMNTIKYGVETKMAALTLSNLRPDINKLRSLVDIYLSKGARAPFTCILRDPVHGEFAPGNYPALWSYAMGVAVVQNKAMQQYVTGRTYLDMEMFLLGQAVAKDADSKISSALEEELGVTDTAKERLRHHLTNLSGGDGAYHKPTGGGAIEVAIDHTDITFGAEDTADRDNKNWTNNSNERWMNHSINNHTITISGAEELEEETNDEDITDIENKIARRLADRKQRLSQANNRQDASSDADHENDDDATAAAGIGGI

  • Tag:

    N-terminal 10xHis-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Microbiology

  • Relevance:

    Encapsidates the genome in a ratio of 1 N per 6 ribonucleotides, protecting it from nucleases. The nucleocapsid (NC) has a helical structure. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases (By similarity) .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    63.6 kDa

  • References & Citations:

    "Sequence analysis and expression of the human parainfluenza type 1 virus nucleoprotein gene." Matsuoka Y., Ray R. Virology 181:403-407 (1991)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length