Recombinant Feline calicivirus Capsid protein VP1, partial

• Product Name Alternative:

  Coat protein; Protein 73 kDa

• Abbreviation:

  Recombinant Feline calicivirus ORF2 protein, partial

• Gene Name:

  ORF2

• UniProt:

  P27404

• Expression Region:

  112-395aa

• Organism:

  Feline calicivirus (strain CFI/68 FIV) (FCV)

• Target Sequence:

  EGWDPNLPLFRLEADDGSITTPEQGTMVGGVIAEPNAQMSTAADMATGKSVDSEWEAFFSFHTSVNWSTSETQGKILFKQSLGPLLNPYLTHLAKLYVAWSGSVDVRFSISGSGVFGGKLAAIVVPPGIDPVQSTSMLQYPHVLFDARQVEPVIFSIPDLRSTLYHLMSDTDTTSLVIMVYNDLINPYANDSNSSGCIVTVETKPGPDFKFHLLKPPGSMLTHGSIPSDLIPKSSSLWIGNRFWSDITDFVIRPFVFQANRHFDFNQETAGWSTPRFRPITITI

• Tag:

  C-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Capsid protein self assembles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assembled as icosahedron with T=1 symmetry. The capsid encapsulates the genomic RNA and is decorated with VP2 proteins. Attaches virion to target cells by binding to feline junctional adhesion molecule A (F11R) and/or to alpha-2,6-linked sialic acid. Once attached, the virion is endocytosed. Acidification of the endosome induces conformational change of capsid protein thereby injecting virus genomic RNA into host cytoplasm

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  38.2 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial