Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial (Active)

• Product Name Alternative:

  Tumor necrosis factor receptor superfamily member 3; Lymphotoxin-beta receptor; Ltbr; Tnfcr, Tnfrsf3

• Abbreviation:

  Recombinant Mouse Ltbr protein, partial (Active)

• Gene Name:

  Ltbr

• UniProt:

  P50284

• Expression Region:

  31-223aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  QLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLL

• Tag:

  C-terminal hFc1-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cell Biology

• Relevance:

  Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Activates NF-kappa-B signaling upon stimulation with lymphotoxin. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs. (Microbial infection) Plays a role in host defense against Zika virus infection.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Mouse Ltbr at 2 μg/mL can bind Biotinylated human TNFSF14 (CSB-MP023991HUj7-B) . The EC50 is 5.428-6.174 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  50.6 kDa

• References & Citations:

  Salivary factor LTRIN from Aedes aegypti facilitates the transmission of Zika virus by interfering with the lymphotoxin-beta receptor. Jin L., Guo X., Shen C., Hao X., Sun P., Li P., Xu T., Hu C., Rose O., Lai R. Nat. Immunol. 19:342-353 (2018)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial