Recombinant Mouse Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (Itpripl1), partial (Active)

• Product Name Alternative:

  Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1; Itpripl1

• Abbreviation:

  Recombinant Mouse Itpripl1 protein, partial (Active)

• Gene Name:

  Itpripl1

• UniProt:

  A2ASA8

• Expression Region:

  23-96aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  DRMDLDTLARSRQLEKRMSEEMRQLEMEFEERSRAAEQKQKVENFWRGDTSSDQLVLGKKDMGWPFQAGGQDGG

• Tag:

  C-terminal 10xHis-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Others

• Relevance:

  Functions as a ligand of CD3E, inhibiting TCR-CD3 complex signaling to regulate T cell activation. Induces stable CD3E-NCK1 binding, thereby preventing the CD3E-ZAP70 interaction and subsequently inhibiting the activation of the downstream ERK-NFkB signaling cascade and calcium influx.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Mouse Itpripl1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU) . The EC50 is 0.7534-0.9877 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  10.0 kDa

• References & Citations:

  ITPRIPL1 binds CD3epsilon to impede T cell activation and enable tumor immune evasion. Deng S., Zhang Y., Wang H., Liang W., Xie L., Li N., Fang Y., Wang Y., Liu J., Xu J. Cell 187:2305-2323.e33 (2024)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial