Recombinant Mouse Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (Itpripl1), partial (Active)

CAT:
399-GTR13447671
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (Itpripl1), partial (Active)

  • Product Name Alternative:

    Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1; Itpripl1

  • Abbreviation:

    Recombinant Mouse Itpripl1 protein, partial (Active)

  • Gene Name:

    Itpripl1

  • UniProt:

    A2ASA8

  • Expression Region:

    23-96aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    DRMDLDTLARSRQLEKRMSEEMRQLEMEFEERSRAAEQKQKVENFWRGDTSSDQLVLGKKDMGWPFQAGGQDGG

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Others

  • Relevance:

    Functions as a ligand of CD3E, inhibiting TCR-CD3 complex signaling to regulate T cell activation. Induces stable CD3E-NCK1 binding, thereby preventing the CD3E-ZAP70 interaction and subsequently inhibiting the activation of the downstream ERK-NFkB signaling cascade and calcium influx.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Mouse Itpripl1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU) . The EC50 is 0.7534-0.9877 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    10.0 kDa

  • References & Citations:

    ITPRIPL1 binds CD3epsilon to impede T cell activation and enable tumor immune evasion. Deng S., Zhang Y., Wang H., Liang W., Xie L., Li N., Fang Y., Wang Y., Liu J., Xu J. Cell 187:2305-2323.e33 (2024)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial