Recombinant Human Netrin receptor UNC5C (UNC5C) (A150V), partial

• Product Name Alternative:

  Protein unc-5 homolog 3; Protein unc-5 homolog C

• Abbreviation:

  Recombinant Human UNC5C protein (A150V), partial

• Gene Name:

  UNC5C

• UniProt:

  O95185-2

• Expression Region:

  61-270aa (A150V)

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSVGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS

• Tag:

  C-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  Yeast

• Field of Research:

  Neuroscience

• Relevance:

  Receptor for netrin required for axon guidance (By similarity) . Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding (By similarity) . NTN1/Netrin-1 binding might cause dissociation of UNC5C from polymerized TUBB3 in microtubules and thereby lead to increased microtubule dynamics and axon repulsion (PubMed:28483977) . Axon repulsion in growth cones may also be caused by its association with DCC that may trigger signaling for repulsion (By similarity) . Might also collaborate with DSCAM in NTN1-mediated axon repulsion independently of DCC (By similarity) . Also involved in corticospinal tract axon guidance independently of DCC (By similarity) . Involved in dorsal root ganglion axon projection towards the spinal cord (PubMed:28483977) . It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand (By similarity) .

• Endotoxin:

  Not test

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  25.8 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial of Isoform 2