Recombinant Pig Interleukin-2 receptor subunit alpha (IL2RA), partial

• Product Name Alternative:

  IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA; CD antigen CD25

• Abbreviation:

  Recombinant Pig IL2RA protein, partial

• Gene Name:

  IL2RA

• UniProt:

  O02733

• Expression Region:

  22-245aa

• Organism:

  Sus scrofa (Pig)

• Target Sequence:

  GACVQQPPSLRNATFKILGYKVGTTLNCDCQRGFRRDPSSGPYMICRGNSSHSFWENKCQCMPTSSPRIPVKQVTPRPEEQKERKTTETQGQMQPPNQANLPGHCKEPPPWEHESLKRVYHFMEGQTVRYQCLPGFRDGSAQNNSAQSVCKKQEDQEVMRWTQPKLKCKSEKENGSFPEPQMSTAAPPTTKTSLPTRTKGTTDSQNLTEVPATMQPIIFTTQYQ

• Tag:

  C-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  32.2 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial