Recombinant Human Thymic stromal lymphopoietin protein (TSLP) (Active)

• Abbreviation:

  Recombinant Human TSLP protein (Active)

• Gene Name:

  TSLP

• UniProt:

  Q969D9

• Expression Region:

  29-159aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  M+YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

• Tag:

  Tag-Free

• Type:

  Active Protein & In Stock Protein

• Source:

  E.Coli

• Field of Research:

  Immunology

• Relevance:

  Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c (+) dendritic cells. Can induce allergic inflammation by directly activating mast cells. {ECO:0000269|PubMed:11418668, ECO:0000269|PubMed:11480573, ECO:0000269|PubMed:17242164}.; Isoform 2: May act as an antimicrobial peptide in the oral cavity and on the skin. {ECO:0000269|PubMed:24850429}.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  >98% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-7Rα and human TSLP R co-transfected murine BaF3 pro-B cells is less than 0.3 ng/ml, corresponding to a specific activity of > 3.3 x 106 IU/mg.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150 mM NaCl

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Isoform 1

• Molecular Weight:

  15.1 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein