Recombinant Human Fibroblast growth factor 8 (FGF8), partial

CAT:
399-GTR04831704
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Fibroblast growth factor 8 (FGF8), partial

  • Product Name Alternative:

    FGF-8; Androgen-induced growth factor; AIGF; Heparin-binding growth factor 8; HBGF-8

  • Abbreviation:

    Recombinant Human FGF8 protein, partial

  • Gene Name:

    FGF8

  • UniProt:

    P55075

  • Expression Region:

    23-143aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    QEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGK

  • Tag:

    N-terminal 6xHis-GST-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Cancer

  • Relevance:

    Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (PubMed:16384934, PubMed:16597617, PubMed:8663044) . Plays a role in neurite outgrowth in hippocampal cells (PubMed:21576111) .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    44.9 kDa

  • References & Citations:

    "Senataxin modulates neurite growth through fibroblast growth factor 8 signalling." Vantaggiato C., Bondioni S., Airoldi G., Bozzato A., Borsani G., Rugarli E.I., Bresolin N., Clementi E., Bassi M.T. Brain 134:1808-1828 (2011)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial