Recombinant Human herpesvirus 6B G-protein coupled receptor (U12), partial

• Abbreviation:

  Recombinant Human herpesvirus 6B G-protein coupled receptor protein, partial

• Gene Name:

  U12

• UniProt:

  Q9QJ51

• Expression Region:

  1-39aa

• Organism:

  Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

• Target Sequence:

  MDTVIELSKLLHDEEFKDNASCTSTPTLKTARIIESAVT

• Tag:

  N-terminal 6xHis-KSI-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  19.6 kDa

• References & Citations:

  "A strongly immunoreactive virion protein of human herpesvirus 6 variant B strain Z29: identification and characterization of the gene and mapping of a variant-specific monoclonal antibody reactive epitope." Pellett P.E., Sanchez-Martinez D., Dominguez G., Black J.B., Anton E., Greenamoyer C., Dambaugh T.R. Virology 195:521-531 (1993)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial