Recombinant Human VEGF coregulated chemokine 1 protein (CXCL17) (Active)

• Product Name Alternative:

  C-X-C motif chemokine 17, DMC

• Abbreviation:

  Recombinant Human CXCL17 protein (Active)

• Gene Name:

  CXCL17

• UniProt:

  Q6UXB2

• Expression Region:

  22-119aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL

• Tag:

  Tag-Free

• Type:

  Active Protein & In Stock Protein

• Source:

  E.Coli

• Field of Research:

  Immunology

• Relevance:

  Plays a role in angiogenesis and possibly in the development of tumors. May be a housekeeping chemokine regulating recruitment of nonactivated blood monocytes and immature dendritic cells into tissues. May play a role in the innate defense against infections. {ECO:0000269|PubMed:16455961, ECO:0000269|PubMed:16989774, ECO:0000269|PubMed:17307946}.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  >96% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/mg.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 µm filtered PBS, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Chemokine that acts as chemoattractant for monocytes, macrophages and dendritic cells

• Molecular Weight:

  11.5 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein