Recombinant Mouse Synaptic vesicle glycoprotein 2A (Sv2a), partial

• Product Name Alternative:

  Synaptic vesicle protein 2; Synaptic vesicle protein 2A; Calcium regulator SV2A

• Abbreviation:

  Recombinant Mouse Sv2a protein, partial

• Gene Name:

  Sv2a

• UniProt:

  Q9JIS5

• Expression Region:

  469-598aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  PDMIRHLQAVDYAARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVY

• Tag:

  C-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. Positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles.; (Microbial infection) Receptor for C.botulinum neurotoxin type A (BoNT/A, botA) ; the toxin probably binds via extracellular loop 4. ; (Microbial infection) Possible receptor for C.botulinum neurotoxin type D (BoNT/D, botD) ; BoNT/D does not bind to extracellular loop 4 as do BoNT/A and BoNT/E. ; (Microbial infection) Receptor for C.botulinum neurotoxin type E (BoNT/E) ; the toxin probably binds via extracellular loop 4. It probably requires glycosylation of Asn-573.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  22.1 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial