Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial

CAT:
399-GTR04831284
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial

  • Product Name Alternative:

    Sodium-dependent phosphate transport protein 2B; Sodium-phosphate transport protein 2B; Na (+) -dependent phosphate cotransporter 2B; NaPi3b; Sodium/phosphate cotransporter 2B; Na (+) /Pi cotransporter 2B; NaPi-2b; Solute carrier family 34 member 2

  • Abbreviation:

    Recombinant Human SLC34A2 protein, partial

  • Gene Name:

    SLC34A2

  • UniProt:

    O95436-1

  • Expression Region:

    234-362aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL

  • Tag:

    C-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Signal Transduction

  • Relevance:

    Involved in actively transporting phosphate into cells via Na+ cotransport.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    21.7 kDa

  • References & Citations:

    New insights in the genetic variant spectrum of SLC34A2 in pulmonary alveolar microlithiasis; a systematic review. Jonsson A.L.M., Hilberg O., Simonsen U., Christensen J.H., Bendstrup E. Orphanet J Rare Dis 18:130-130 (2023)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial