Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial (Active)

CAT:
399-GTR04832379
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial (Active)

  • Product Name Alternative:

    Low affinity immunoglobulin gamma Fc region receptor II-a; IgG Fc receptor II-a; CDw32; Fc-gamma RII-a (Fc-gamma-RIIa; FcRII-a) ; CD32; FCGR2A; CD32, FCG2, FCGR2A1, IGFR2

  • Abbreviation:

    Recombinant Human FCGR2A protein, partial (Active)

  • Gene Name:

    FCGR2A

  • UniProt:

    P12318

  • Expression Region:

    34-217aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Immunology

  • Relevance:

    Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human FCGR2A at 2 μg/mL can bind Anti-FCGR2A recombinant antibody (CSB-RA008540MA1HU) . The EC50 is 24.44-32.57 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    23.2 kDa

  • References & Citations:

    The DNA sequence and biological annotation of human chromosome 1. Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Bentley D.R. Nature 441:315-321 (2006)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial