Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)

CAT:
399-GTR04830842
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)

  • Product Name Alternative:

    Blood dendritic cell antigen 2 ; BDCA-2; C-type lectin superfamily member 7Dendritic lectin; CD303

  • Abbreviation:

    Recombinant Human CLEC4C protein, partial (Active)

  • Gene Name:

    CLEC4C

  • UniProt:

    Q8WTT0

  • Expression Region:

    45-213aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Immunology

  • Relevance:

    Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    36 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial