Recombinant Human Fragile X mental retardation syndrome-related protein 1 (FXR1), partial

CAT:
399-GTR04828649
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Fragile X mental retardation syndrome-related protein 1 (FXR1), partial

  • Product Name Alternative:

    (FMR1 autosomal homolog 1) (hFXR1p)

  • Abbreviation:

    Recombinant Human FXR1 protein, partial

  • Gene Name:

    FXR1

  • UniProt:

    P51114

  • Expression Region:

    123-199aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    KNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLM

  • Tag:

    C-terminal 6xHis-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Epigenetics and Nuclear Signaling

  • Relevance:

    RNA-binding protein required for embryonic and postnatal development of muscle tissue . May regulate intracellular transport and local translation of certain mRNAs .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    9.8 kDa

  • References & Citations:

    "Recessive mutations in muscle-specific isoforms of FXR1 cause congenital multi-minicore myopathy." Estan M.C., Fernandez-Nunez E., Zaki M.S., Esteban M.I., Donkervoort S., Hawkins C., Caparros-Martin J.A., Saade D., Hu Y., Bolduc V., Chao K.R., Nevado J., Lamuedra A., Largo R., Herrero-Beaumont G., Regadera J., Hernandez-Chico C., Tizzano E.F. Ruiz-Perez V.L. Nat. Commun. 10:797-797 (2019)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial