Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1

CAT:
399-GTR04834635
Size:
200 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1

  • Product Name Alternative:

    PT-Mice-Ins-beta NaTx6.1 (Tityustoxin VII) (Ts VII) (Ts7) (TsTX-VII) (Toxin II-11) (Toxin III-10) (Toxin T2-IV) (Toxin gamma) (TsTX-I)

  • Abbreviation:

    Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 protein

  • UniProt:

    P15226

  • Expression Region:

    21-81aa

  • Organism:

    Tityus serrulatus (Brazilian scorpion)

  • Target Sequence:

    KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. In addition, it stimulates the release of NO, IL-6 and TNF-alpha in J774.1 cells. This toxin is active against both mammals and insects.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    14.3 kDa

  • References & Citations:

    "Amino acid sequence of toxin VII, a beta-toxin from the venom of the scorpion Tityus serrulatus." Bechis G., Sampieri F., Yuan P.-M., Brando T., Martin M.-F., Diniz C.R., Rochat H. Biochem. Biophys. Res. Commun. 122:1146-1153 (1984)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein