Recombinant Mouse CMRF35-like molecule 6 (Cd300c), partial

• Product Name Alternative:

  (CLM-6) (CD300 antigen-like family member C) (CD antigen CD300c)

• Abbreviation:

  Recombinant Mouse Cd300c protein, partial

• Gene Name:

  Cd300c

• UniProt:

  A2A7V7

• Expression Region:

  22-188aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  HFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPH

• Tag:

  N-terminal GST-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  45.8 kDa

• References & Citations:

  "CMRF-35-like molecule-1, a novel mouse myeloid receptor, can inhibit osteoclast formation." Chung D.-H., Humphrey M.B., Nakamura M.C., Ginzinger D.G., Seaman W.E., Daws M.R. J. Immunol. 171:6541-6548 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial