Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-1 (X20S, X45S, X48S, X51S, X53S, X98S, X107S), partial

CAT:
399-GTR04828566
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-1 (X20S, X45S, X48S, X51S, X53S, X98S, X107S), partial

  • Product Name Alternative:

    (Nepenthesin-I)

  • Abbreviation:

    Recombinant Nepenthes distillatoria Nepenthesin-I protein (Mutant type), partial

  • UniProt:

    P69476

  • Expression Region:

    1-164aa (X20N, X45C, X48C, X51C, X53N, X98C, X107S)

  • Organism:

    Nepenthes distillatoria (Pitcher plant)

  • Target Sequence:

    IGPSGVETTVYAGDGEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQPCTQCFNQSDPQGSSSFSTLPCGYGDSETQGSMGTETFTFGSVSIPNITFGCGEGPLPLPSQLDVAKYITLDLPIDPSAFDLCFQTPSDPSNLQIPTFVMHFDTGNSVVSFVSAQCGA

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Extracellular proteinase found in the pitcher fluid of carnivorous plants. Digest prey for nitrogen uptake.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    24.7 kDa

  • References & Citations:

    "Enzymic and structural characterization of nepenthesin, a unique member of a novel subfamily of aspartic proteinases." Athauda S.B.P., Matsumoto K., Rajapakshe S., Kuribayashi M., Kojima M., Kubomura-Yoshida N., Iwamatsu A., Shibata C., Inoue H., Takahashi K. Biochem. J. 381:295-306 (2004)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial