Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial, Biotinylated

• Product Name Alternative:

  (B-cell maturation protein) (CD antigen CD269)

• Abbreviation:

  Recombinant Human TNFRSF17 protein, partial, Biotinylated

• Gene Name:

  TNFRSF17

• UniProt:

  Q02223

• Expression Region:

  1-54aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

• Tag:

  C-terminal mFc-Avi-tagged

• Type:

  In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  34.9 kDa

• References & Citations:

  "A new gene, BCM, on chromosome 16 is fused to the interleukin 2 gene by a t (4;16) (q26; p13) translocation in a malignant T cell lymphoma." Laabi Y., Gras M.P., Carbonnel F., Brouet J.C., Berger R., Larsen C.-J., Tsapis A. EMBO J. 11:3897-3904 (1992)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial