Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22 (rplV)

CAT:
399-GTR04822592
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22 (rplV)

  • Product Name Alternative:

    RplV; APH_0285; 50S ribosomal protein L22

  • Abbreviation:

    Recombinant Anaplasma phagocytophilum rplV protein

  • Gene Name:

    RplV

  • UniProt:

    Q2GL54

  • Expression Region:

    1-112aa

  • Organism:

    Anaplasma phagocytophilum (strain HZ)

  • Target Sequence:

    MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER

  • Tag:

    N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

  • Type:

    Developed Protein

  • Source:

    In vitro E.coli expression system

  • Field of Research:

    Epigenetics and Nuclear Signaling

  • Relevance:

    This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome (By similarity) .

  • Molecular Weight:

    32.2 kDa

  • References & Citations:

    "Comparative genomics of emerging human ehrlichiosis agents."Dunning Hotopp J.C., Lin M., Madupu R., Crabtree J.Tettelin H. PLoS Genet. 2:208-222 (2006)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length