Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB)

CAT:
399-GTR04778084
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB)

  • Product Name Alternative:

    Antigen CD42b-beta CD_antigen: CD42c

  • Abbreviation:

    Recombinant Human GP1BB protein

  • Gene Name:

    GP1BB

  • UniProt:

    P13224

  • Expression Region:

    26-206aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES

  • Tag:

    N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

  • Type:

    CF Transmembrane Protein & In Stock Protein

  • Source:

    In vitro E.coli expression system

  • Field of Research:

    Others

  • Relevance:

    Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.

  • Molecular Weight:

    39.3 kDa

  • References & Citations:

    "The alpha and beta chains of human platelet glycoprotein Ib are both transmembrane proteins containing a leucine-rich amino acid sequence." Lopez J.A., Chung D.W., Fujikawa K., Hagen F.S., Davie E.W., Roth G.J. Proc. Natl. Acad. Sci. U.S.A. 85:2135-2139 (1988)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein