Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial

• Product Name Alternative:

  Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2

• Abbreviation:

  Recombinant Human SLC5A2 protein, partial

• Gene Name:

  SLC5A2

• UniProt:

  P31639

• Expression Region:

  1-102aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA

• Tag:

  N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

• Type:

  CF Transmembrane Protein & Developed Protein

• Source:

  In vitro E.coli expression system

• Field of Research:

  Signal Transduction

• Relevance:

  Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Sodium-dependent glucose transporter. Has a Na (+) to glucose coupling ratio of 1

• Molecular Weight:

  30.5 kDa

• References & Citations:

  "Novel compound heterozygous mutations in SLC5A2 are responsible for autosomal recessive renal glucosuria." Calado J., Soto K., Clemente C., Correia P., Rueff J. Hum. Genet. 114:314-316 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial