Recombinant Human Serpin A9 (SERPINA9)

• Product Name Alternative:

  Centerin (Germinal center B-cell-expressed transcript 1 protein) (GCET1) (SERPINA11)

• Abbreviation:

  Recombinant Human SERPINA9 protein

• Gene Name:

  SERPINA9

• UniProt:

  Q86WD7

• Expression Region:

  24-417aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  ANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Others

• Relevance:

  Protease inhibitor that inhibits trypsin and trypsin-like serine proteases. Inhibits plasmin and thrombin with lower efficiency

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Protease inhibitor that inhibits trypsin and trypsin-like serine proteases (in vitro) . Inhibits plasmin and thrombin with lower efficiency (in vitro) .

• Molecular Weight:

  49.1 kDa

• References & Citations:

  "Two newly characterized germinal center B-cell-associated genes, GCET1 and GCET2, have differential expression in normal and neoplastic B cells." Pan Z., Shen Y., Du C., Zhou G., Rosenwald A., Staudt L.M., Greiner T.C., McKeithan T.W., Chan W.C. Am. J. Pathol. 163:135-144 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein