Recombinant Mouse Phospholipase A-2-activating protein (Plaa), partial

• Product Name Alternative:

  PLA2P (PLAP) (Plap)

• Abbreviation:

  Recombinant Mouse Plaa protein, partial

• Gene Name:

  Plaa

• UniProt:

  P27612

• Expression Region:

  495-584aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  Baculovirus

• Field of Research:

  Immunology

• Relevance:

  Plays a role in protein ubiquitination, sorting and degradation through its association with VCP. Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. Plays a role in cerebellar Purkinje cell development (PubMed:28413018) . Positively regulates cytosolic and calcium-independent phospholipase A2 activities in a tumor necrosis factor alpha- or lipopolysaccharide-dependent manner, and hence prostaglandin E2 biosynthesis.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  13.6 kDa

• References & Citations:

  "Cloning of a rat cDNA encoding a protein with high homology to mouse phospholipase A2-activating protein." Wang H., Lemasters J.J., Herman B. Gene 161:237-241 (1995)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial