Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17)
Product Name Alternative:
Auxin response 3 (Indoleacetic acid-induced protein 17) (AXR3)
Abbreviation:
Recombinant Mouse-ear cress IAA17 protein
Gene Name:
IAA17
UniProt:
P93830
Expression Region:
1-229aa
Organism:
Arabidopsis thaliana (Mouse-ear cress)
Target Sequence:
MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA
Tag:
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Type:
In Stock Protein
Source:
E.coli
Field of Research:
Cell Biology
Relevance:
Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors, proteins that bind to the auxin-responsive promoter element. Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.
Endotoxin:
Not test
Purity:
Greater than 85% as determined by SDS-PAGE.
Activity:
Not Test
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function:
Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE) . Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.
Molecular Weight:
32.3 kDa
References & Citations:
"Functional genomic analysis of the AUXIN/INDOLE-3-ACETIC ACID gene family members in Arabidopsis thaliana." Overvoorde P.J., Okushima Y., Alonso J.M., Chan A., Chang C., Ecker J.R., Hughes B., Liu A., Onodera C., Quach H., Smith A., Yu G., Theologis A. Plant Cell 17:3282-3300 (2005)
Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length:
Full Length