Recombinant Human Cell surface hyaluronidase (TMEM2), partial

• Product Name Alternative:

  Transmembrane protein 2 (KIAA1412)

• Abbreviation:

  Recombinant Human TMEM2 protein, partial

• Gene Name:

  TMEM2

• UniProt:

  Q9UHN6

• Expression Region:

  104-250aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  SSKYAPDENCPDQNPRLRNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYILIQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASWTLLARTLNSS

• Tag:

  N-terminal 10xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Cell Biology

• Relevance:

  Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments. Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of extracellular hyaluronan, thereby regulating VEGF signaling. Is very specific to hyaluronan; not able to cleave chondroitin sulfate or dermatan sulfate

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments

• Molecular Weight:

  21.5 kDa

• References & Citations:

  "Refining the DFNB7-DFNB11 deafness locus using intragenic polymorphisms in a novel gene, TMEM2." Scott D.A., Drury S., Sundstrom R.A., Bishop J., Swiderski R.E., Carmi R., Ramesh A., Elbedour K., Srikumari Srisailapathy C.R., Keats B.J., Sheffield V.C., Smith R.J.H. Gene 246:265-274 (2000)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial