Recombinant Human Early growth response protein 1 (EGR1), partial

CAT:
399-GTR04837057
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Early growth response protein 1 (EGR1), partial

  • Product Name Alternative:

    AT225 (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24) (KROX24) (ZNF225)

  • Abbreviation:

    Recombinant Human EGR1 protein, partial

  • Gene Name:

    EGR1

  • UniProt:

    P18146

  • Expression Region:

    444-543aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

  • Tag:

    N-terminal 6xHis-B2M-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Transcription

  • Relevance:

    Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3' (EGR-site) . Activates the transcription of target genes whose products are required for mitogenesis and differentiation.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Transcriptional regulator

  • Molecular Weight:

    24.1 kDa

  • References & Citations:

    CDNA sequence of the human cellular early growth response gene Egr-1.Suggs S.V., Katzowitz J.L., Tsai-Morris C.-H., Sukhatme V.P.Nucleic Acids Res. 18:4283-4283 (1990)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial