Recombinant Heron hepatitis B virus Protein P (P), partial

• Product Name Alternative:

  P; Protein P [Includes: DNA-directed DNA polymerase; EC 2.7.7.7) ; RNA-directed DNA polymerase; EC 2.7.7.49) ; Ribonuclease H; EC 3.1.26.4) ]

• Abbreviation:

  Recombinant Heron hepatitis B virus protein P, partial

• Gene Name:

  P

• UniProt:

  P13846

• Expression Region:

  376-565aa

• Organism:

  Heron hepatitis B virus (HHBV)

• Target Sequence:

  SYLRGNTSWPNRVTGRIFLVDKNSRNTEEARLVVDFSQFSKGKNAMRFPKYWCPNLTTLRRILPVGMPRISLDLSQAFYHLPLAPASSSRLAVSDGKQVYYFRKAPMGVGLSPFLLHLFTTAIGAEIASRFNVWTFSYMDDFLLCHPSARHLNTISHAVCTFLQEFGIRINFDKMTPSPVTTIRFLGYEI

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Multifunctional enzyme that converts the viral RNA genome into dsDNA in viral cytoplasmic capsids. This enzyme displays a DNA polymerase activity that can copy either DNA or RNA templates, and a ribonuclease H (RNase H) activity that cleaves the RNA strand of RNA-DNA heteroduplexes in a partially processive 3'- to 5'-endonucleasic mode. Neo-synthesized pregenomic RNA (pgRNA) are encapsidated together with the P protein, and reverse-transcribed inside the nucleocapsid. Initiation of reverse-transcription occurs first by binding the epsilon loop on the pgRNA genome, and is initiated by protein priming, thereby the 5'-end of (-) DNA is covalently linked to P protein. Partial (+) DNA is synthesized from the (-) DNA template and generates the relaxed circular DNA (RC-DNA) genome. After budding and infection, the RC-DNA migrates in the nucleus, and is converted into a plasmid-like covalently closed circular DNA (cccDNA) . The activity of P protein does not seem to be necessary for cccDNA generation, and is presumably released from (+) DNA by host nuclear DNA repair machinery

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Multifunctional enzyme that converts the viral RNA genome into dsDNA in viral cytoplasmic capsids. This enzyme displays a DNA polymerase activity that can copy either DNA or RNA templates, and a ribonuclease H (RNase H) activity that cleaves the RNA strand of RNA-DNA heteroduplexes in a partially processive 3'- to 5'-endonucleasic mode. Neo-synthesized pregenomic RNA (pgRNA) are encapsidated together with the P protein, and reverse-transcribed inside the nucleocapsid. Initiation of reverse-transcription occurs first by binding the epsilon loop on the pgRNA genome, and is initiated by protein priming, thereby the 5'-end of (-) DNA is covalently linked to P protein. Partial (+) DNA is synthesized from the (-) DNA template and generates the relaxed circular DNA (RC-DNA) genome. After budding and infection, the RC-DNA migrates in the nucleus, and is converted into a plasmid-like covalently closed circular DNA (cccDNA) . The activity of P protein does not seem to be necessary for cccDNA generation, and is presumably released from (+) DNA by host nuclear DNA repair machinery (By similarity) .

• Molecular Weight:

  28.7 kDa

• References & Citations:

  "Isolation and characterization of a hepatitis B virus endemic in herons." Sprengel R., Kaleta E.F., Will H. J. Virol. 62:3832-3839 (1988)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial