Recombinant Human C-X-C motif chemokine 10 (CXCL10)

• Product Name Alternative:

  10 kDa interferon gamma-induced protein INP10, SCYB10

• Abbreviation:

  Recombinant Human CXCL10 protein

• Gene Name:

  CXCL10

• UniProt:

  P02778

• Expression Region:

  22-98aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

• Tag:

  C-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Cancer

• Relevance:

  Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

• Molecular Weight:

  10.6 kDa

• References & Citations:

  "Human IP-9: a keratinocyte derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3) ." Tensen C.P., Flier J., van der Raaij-Helmer E.M.H., Sampat-Sardjoepersad S., van der Schors R.C., Leurs R., Scheper R.J., Boorsma D.M., Willemze R. J. Invest. Dermatol. 112:716-722 (1999)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein