Recombinant Rat Sulfotransferase family cytosolic 1B member 1 (Sult1b1)

• Product Name Alternative:

  DOPA/tyrosine sulfotransferase

• Abbreviation:

  Recombinant Rat Sult1b1 protein

• Gene Name:

  Sult1b1

• UniProt:

  P52847

• Expression Region:

  1-299aa

• Organism:

  Rattus norvegicus (Rat)

• Target Sequence:

  MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA

• Tag:

  N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Signal Transduction

• Relevance:

  Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. sulfonation of DOPA, tyrosine isomers and thyroid hormones such as 3,3',5-triiodothyronine and 3,3'-diiodothyronine. May play a role in the limitation of the production of L-DOPA and L-m-tyrosine and also in facilitating their excretion.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. sulfonation of DOPA, tyrosine isomers and thyroid hormones such as 3,3',5-triiodothyronine and 3,3'-diiodothyronine. May play a role in the limitation of the production of L-DOPA and L-m-tyrosine and also in facilitating their excretion.

• Molecular Weight:

  54.8 kDa

• References & Citations:

  "Purification, characterization, and molecular cloning of a novel rat liver Dopa/tyrosine sulfotransferase." Sakakibara Y., Takami Y., Zwieb C., Nakayama T., Suiko M., Nakajima H., Liu M.-C. J. Biol. Chem. 270:30470-30478 (1995)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length