Recombinant Human rhinovirus A serotype 89 Genome polyprotein, partial
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Human rhinovirus A serotype 89 Genome polyprotein, partial
Product Name Alternative:
Genome polyprotein [Cleaved into: P1; Capsid protein VP0; VP4-VP2) ; Capsid protein VP4; P1A; Virion protein 4) ; Capsid protein VP2; P1B; Virion protein 2) ; Capsid protein VP3; P1C; Virion protein 3) ; Capsid protein VP1; P1D; Virion protein 1) ; P2; Protease 2A; P2A; EC 3.4.22.29; Picornain 2A; Protein 2A) ; Protein 2B; P2B) ; Protein 2C; P2C; EC 3.6.1.15) ; P3; Protein 3AB; Protein 3A; P3A) ; Viral protein genome-linked; VPg; Protein 3B; P3B) ; Protein 3CD; EC 3.4.22.28) ; Protease 3C; EC 3.4.22.28; Picornain 3C; P3C) ; RNA-directed RNA polymerase; RdRp; EC 2.7.7.48; 3D polymerase; 3Dpol; Protein 3D; 3D) ]
Abbreviation:
Recombinant Human rhinovirus A serotype 89 Genome polyprotein, partial
UniProt:
P07210
Expression Region:
575-866aa
Organism:
Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)
Target Sequence:
NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV
Tag:
N-terminal 10xHis-tagged
Type:
In Stock Protein
Source:
E.coli
Field of Research:
Others
Relevance:
Capsid protein VP1: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome. Capsid protein VP1 mainly forms the vertices of the capsid. Capsid protein VP1 interacts with host cell receptor to provide virion attachment to target host cells. This attachment induces virion internalization. Tyrosine kinases are probably involved in the entry process. After binding to its receptor, the capsid undergoes conformational changes. Capsid protein VP1 N-terminus (that contains an amphipathic alpha-helix) and capsid protein VP4 are externalized. Together, they shape a pore in the host membrane through which viral genome is translocated to host cell cytoplasm. After genome has been released, the channel shrinks
Endotoxin:
Not test
Purity:
Greater than 85% as determined by SDS-PAGE.
Activity:
Not Test
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function:
Capsid protein VP1
Molecular Weight:
38.1 kDa
References & Citations:
"Evolutionary relationships within the human rhinovirus genus: comparison of serotypes 89, 2, and 14." Duechler M., Skern T., Sommergruber W., Neubauer C., Gruendler P., Fogy I., Blaas D., Kuechler E. Proc. Natl. Acad. Sci. U.S.A. 84:2605-2609 (1987)
Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length:
Partial