Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial

• Product Name Alternative:

  D-serine transporter Solute carrier family 7 member 10

• Abbreviation:

  Recombinant Mouse Slc7a10 protein, partial

• Gene Name:

  Slc7a10

• UniProt:

  P63115

• Expression Region:

  475-530aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ

• Tag:

  N-terminal 6xHis-sumostar-tagged

• Type:

  In Stock Protein

• Source:

  Yeast

• Field of Research:

  Others

• Relevance:

  Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.

• Molecular Weight:

  22.5 kDa

• References & Citations:

  "Identification and characterization of a Na+-independent neutral amino acid transporter that associates with the 4F2 heavy chain and exhibits substrate selectivity for small neutral D- and L- amino acids." Fukasawa Y., Segawa H., Kim J.Y., Chairoungdua A., Kim D.K., Matsuo H., Cha S.H., Endou H., Kanai Y. J. Biol. Chem. 275:9690-9698 (2000)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial