Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial (COX7A2L)

CAT:
399-GTR04834077
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial (COX7A2L)

  • Product Name Alternative:

    COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1

  • Abbreviation:

    Recombinant Human COX7A2L protein

  • Gene Name:

    COX7A2L

  • UniProt:

    O14548

  • Expression Region:

    1-114aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

  • Tag:

    N-terminal GST-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Signal Transduction

  • Relevance:

    Involved in the regulation of oxidative phosphorylation and energy metabolism. Necessary for the assembly of mitochondrial respiratory supercomplex

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity) . Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity) .

  • Molecular Weight:

    39.6 kDa

  • References & Citations:

    "Isolation of estrogen-responsive genes with a CpG island library." Watanabe T., Inoue S., Hiroi H., Orimo A., Kawashima H., Muramatsu M. Mol. Cell. Biol. 18:442-449 (1998)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length