Recombinant Human 28S ribosomal protein S16, mitochondrial (MRPS16)

• Product Name Alternative:

  28S ribosomal protein S16; 28S ribosomal protein S16 mitochondrial; CGI-132; COXPD2; mitochondrial; Mitochondrial ribosomal protein S16; MRP-S16; mrps16; RPMS16; RT16_HUMAN; S16mt

• Abbreviation:

  Recombinant Human MRPS16 protein

• Gene Name:

  MRPS16

• UniProt:

  Q9Y3D3

• Expression Region:

  1-137aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

• Tag:

  N-terminal GST-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Epigenetics and Nuclear Signaling

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  38.5 kDa

• References & Citations:

  "Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28S small subunit." Suzuki T., Terasaki M., Takemoto-Hori C., Hanada T., Ueda T., Wada A., Watanabe K. J. Biol. Chem. 276:33181-33195 (2001)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length