Recombinant Human Centrin-3 (CETN3)

• Product Name Alternative:

  CDC31 homolog; CEN 3; CEN3; Centrin EF hand protein 3; Centrin-3; Centrin3; CETN 3; Cetn3; CETN3_HUMAN; EF hand superfamily member; MGC12502; MGC138245

• Abbreviation:

  Recombinant Human CETN3 protein

• Gene Name:

  CETN3

• UniProt:

  O15182

• Expression Region:

  1-167aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI

• Tag:

  N-terminal GST-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Tags & Cell Markers

• Relevance:

  Plays a fundamental role in microtubule-organizing center structure and function. Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, DSS1, and either centrin CETN2 or CETN3. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket) . TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Plays a fundamental role in microtubule-organizing center structure and function.; FUNCTION

• Molecular Weight:

  46.5 kDa

• References & Citations:

  "Identification of a new mammalian centrin gene, more closely related to Saccharomyces cerevisiae CDC31 gene." Middendorp S., Paoletti A., Schiebel E., Bornens M. Proc. Natl. Acad. Sci. U.S.A. 94:9141-9146 (1997)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length