Recombinant Human p53-regulated apoptosis-inducing protein 1 (TP53AIP1)

• Product Name Alternative:

  P53 regulated apoptosis inducing protein 1; p53-regulated apoptosis-inducing protein 1; P53AIP 1; p53AIP1; TP53AIP 1; TP53AIP1; TPIP1_HUMAN

• Abbreviation:

  Recombinant Human TP53AIP1 protein

• Gene Name:

  TP53AIP1

• UniProt:

  Q9HCN2

• Expression Region:

  1-108aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MGSSSEVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN

• Tag:

  N-terminal GST-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Cell Biology

• Relevance:

  May play an important role in mediating p53/TP53-dependent apoptosis.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  May play an important role in mediating p53/TP53-dependent apoptosis.

• Molecular Weight:

  38.3 kDa

• References & Citations:

  "p53AIP1, a potential mediator of p53-dependent apoptosis, and its regulation by Ser-46-phosphorylated p53." Oda K., Arakawa H., Tanaka T., Matsuda K., Tanikawa C., Mori T., Nishimori H., Tamai K., Tokino T., Nakamura Y., Taya Y. Cell 102:849-862 (2000)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of BC069399