Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial

• Product Name Alternative:

  Antigen identified by monoclonal Ki 67 ; Antigen identified by monoclonal Ki-67; Antigen KI-67; Antigen KI67 ; Antigen Ki67; KI67_HUMAN; KIA; Marker of proliferation Ki-67; MIB 1; MIB; MKI67; PPP1R105; Proliferation marker protein Ki-67; Proliferation related Ki 67 antigen ; Protein phosphatase 1 regulatory subunit 105; RP11-380J17.2

• Abbreviation:

  Recombinant Human MKI67 protein, partial

• Gene Name:

  MKI67

• UniProt:

  P46013

• Expression Region:

  3120-3256aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

• Tag:

  N-terminal 6xHis-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Thought to be required for maintaining cell proliferation.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly

• Molecular Weight:

  19.4 kDa

• References & Citations:

  "The cell proliferation-associated antigen of antibody Ki-67: a very large, ubiquitous nuclear protein with numerous repeated elements, representing a new kind of cell cycle-maintaining proteins."Schlueter C., Duchrow M., Wohlenberg C., Becker M.H.G., Key G., Flad H.-D., Gerdes J.J. Cell Biol. 123:513-522 (1993)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial