Recombinant Chicken (Chicken) Mitochondrial Rho GTPase 1 (RHOT1), partial

• Product Name Alternative:

  MIRO-1 Alternative name (s) : Ras homolog gene family member T1

• Abbreviation:

  Recombinant Chicken RHOT1 protein, partial

• Gene Name:

  RHOT1

• UniProt:

  Q5ZM73

• Expression Region:

  1-219aa

• Organism:

  Gallus gallus (Chicken)

• Target Sequence:

  MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQNDEQLYHEISQANVICIVYAVNNKNSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNRSELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFRISDQDNDGTLNDAELNFFQRICFNT

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Tags & Cell Markers

• Relevance:

  Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity) .

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity) .

• Molecular Weight:

  41 kDa

• References & Citations:

  "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis."Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P., Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P., Hayashizaki Y., Buerstedde J.-M.Genome Biol. 6:R6.1-R6.9 (2005) .

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial