Recombinant Human Thymic stromal lymphopoietin (TSLP)

• Product Name Alternative:

  Thymic stromal lymphopoietin; Thymic stromal lymphopoietin protein TSLP; Tslp; TSLP protein; TSLP_HUMAN

• Abbreviation:

  Recombinant Human TSLP protein

• Gene Name:

  TSLP

• UniProt:

  Q969D9

• Expression Region:

  29-159aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Immunology

• Relevance:

  Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Isoform 1

• Molecular Weight:

  30.9 kDa

• References & Citations:

  "Human thymic stromal lymphopoietin preferentially stimulates myeloid cells."Reche P.A., Soumelis V., Gorman D.M., Clifford T., Liu M.-R., Travis M., Zurawski S.M., Johnston J., Liu Y.-J., Spits H., de Waal Malefyt R., Kastelein R.A., Bazan J.F.J. Immunol. 167:336-343 (2001)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein