Recombinant Mouse Secretoglobin family 3A member 2 (Scgb3a2)

• Product Name Alternative:

  Pneumo secretory protein 1 Short name: PnSP-1 Uteroglobin-related protein 1

• Abbreviation:

  Recombinant Mouse Scgb3a2 protein

• Gene Name:

  Scgb3a2

• UniProt:

  Q920H1

• Expression Region:

  22-139aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  Yeast

• Field of Research:

  Epigenetics and Nuclear Signaling

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Secreted cytokine-like protein (By similarity) . Binds to the scavenger receptor MARCO (By similarity) . Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast (By similarity) . Strongly inhibits phospholipase A2 (PLA2G1B) activity

• Molecular Weight:

  15.2 kDa

• References & Citations:

  "UGRP1, a uteroglobin/Clara cell secretory protein-related protein, is a novel lung-enriched downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor."Niimi T., Keck-Waggoner C.L., Popescu N.C., Zhou Y., Levitt R.C., Kimura S.Mol. Endocrinol. 15:2021-2036 (2001)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein of Isoform C