Recombinant Human Excitatory amino acid transporter 4 (SLC1A6), partial

CAT:
399-GTR04831472
Size:
1 mg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Excitatory amino acid transporter 4 (SLC1A6), partial

  • Product Name Alternative:

    Sodium-dependent glutamate/aspartate transporter Solute carrier family 1 member 6

  • Abbreviation:

    Recombinant Human SLC1A6 protein, partial

  • Gene Name:

    SLC1A6

  • UniProt:

    P48664

  • Expression Region:

    149-271aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL

  • Tag:

    N-terminal GST-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Neuroscience

  • Relevance:

    Transports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate

  • Molecular Weight:

    40.4 kDa

  • References & Citations:

    "An excitatory amino-acid transporter with properties of a ligand-gated chloride channel."Fairman W.A., Vandenberg R.J., Arriza J.L., Kavanaugh M.P., Amara S.G.Nature 375:599-603 (1995)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial