Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial (Active)

• Product Name Alternative:

  /

• Abbreviation:

  Recombinant Human TMPRSS2 protein, partial (Active)

• Gene Name:

  TMPRSS2

• UniProt:

  O15393

• Expression Region:

  106-492aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Active Protein & In Stock Protein & Coronavirus Protein

• Source:

  Yeast

• Field of Research:

  Cancer

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  ①Recombinant Human TMPRSS2 His tag protein (CSB-YP023924HU) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC), The Km is 21.93μM. ②Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-YP023924HU), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) . The Camostat Mesylate inhibit EC50 is 0.03347-0.07945μM.

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  44.8 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial