Recombinant Ophiostoma ulmi CeRato-ulmin (CU)

CAT:
399-GTR04838009
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Ophiostoma ulmi CeRato-ulmin (CU)

  • Product Name Alternative:

    Dutch elm disease toxin

  • Abbreviation:

    Recombinant Ophiostoma ulmi CeRato-ulmin protein

  • Gene Name:

    CU

  • UniProt:

    Q06153

  • Expression Region:

    26-100aa

  • Organism:

    Ophiostoma ulmi (Dutch elm disease fungus)

  • Target Sequence:

    SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    Yeast

  • Field of Research:

    Others

  • Relevance:

    Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.

  • Molecular Weight:

    9.6 kDa

  • References & Citations:

    "Isolation and characterization of the cerato-ulmin toxin gene of the Dutch elm disease pathogen, Ophiostoma ulmi."Bowden C.G., Hintz W.E., Jeng R., Hubbes M., Horgen P.A.Curr. Genet. 25:323-329 (1994)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein