Recombinant Blomia tropicalis Mite allergen Blo t 5 (BLOT5)

• Product Name Alternative:

  Allergen: Blo t 5

• Abbreviation:

  Recombinant Blomia tropicalis BLOT5 protein

• Gene Name:

  BLOT5

• UniProt:

  O96870

• Expression Region:

  1-134aa

• Organism:

  Blomia tropicalis (Mite)

• Target Sequence:

  MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  31.6 kDa

• References & Citations:

  "Sensitization to Blomia tropicalis in patients with asthma and identification of allergen Blo t 5."Arruda L.K., Vailes L.D., Platts-Mills T.A.E., Fernandez-Caldas E., Montealegre F., Lin K.-L., Chua K.-Y., Rizzo M.C., Naspitz C.K., Chapman M.D.Am. J. Respir. Crit. Care Med. 155:343-350 (1997)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length