Recombinant Escherichia coli Lipopolysaccharide export system protein LptA (lptA)

• Product Name Alternative:

  LptA; yhbN; b3200; JW3167; Lipopolysaccharide export system protein LptA

• Abbreviation:

  Recombinant E.coli lptA protein

• Gene Name:

  LptA

• UniProt:

  P0ADV1

• Expression Region:

  28-185aa

• Organism:

  Escherichia coli (strain K12)

• Target Sequence:

  VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  Yeast

• Field of Research:

  Others

• Relevance:

  Involved in the assbly of lipopolysaccharide (LPS) . Required for the translocation of LPS from the inner mbrane to the outer mbrane. May form a bridge between the inner mbrane and the outer mbrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Involved in the assembly of lipopolysaccharide (LPS) . Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

• Molecular Weight:

  19.3 kDa

• References & Citations:

  Non-essential KDO biosynthesis and new essential cell envelope biogenesis genes in the Escherichia coli yrbG-yhbG locus.Sperandeo P., Pozzi C., Deho G., Polissi A.Res. Microbiol. 157:547-558 (2006)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein