Recombinant Mannheimia haemolytica Leukotoxin (lktA), partial

• Product Name Alternative:

  LktA; Leukotoxin; Lkt

• Abbreviation:

  Recombinant Mannheimia haemolytica lktA protein, partial

• Gene Name:

  LktA

• UniProt:

  P0C085

• Expression Region:

  715-953aa

• Organism:

  Mannheimia haemolytica (Pasteurella haemolytica)

• Target Sequence:

  IGTSHNDIFKGSKFNDAFNGGDGVDTIDGNDGNDRLFGGKGDDIIDGGNGDDFIDGGKGNDLLHGGKGDDIFVHRQGDGNDSITESEGNDKLSFSDSNLKDLTFEKVNHHLVITNTKQEKVTIQNWFREAEFAKTIQNYVATRDDKIEEIIGQNGERITSKQVDELIEKGNGKIAQSELTKVVDNYQLLKYSRDASNSLDKLISSASAFTSSNDSRNVLASPTSMLDPSLSSIQFARAA

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  Yeast

• Field of Research:

  Others

• Relevance:

  Pasteurella leukotoxins are exotoxins that attack host leukocytes and especially polymorphonuclear cells, by causing cell rupture. The leukotoxin binds to the host LFA-1 integrin and induces a signaling cascade leading to many biological effects, including tyrosine phosphorylation of the CD18 tail, elevation of the intracellular Ca2+ and lysis of the host cell . This leukotoxin is a major contributor to the pathogenesis of lung injury in ovine pneumonic pasteurellosis. It has also weak holytic activity.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Pasteurella leukotoxins are exotoxins that attack host leukocytes and especially polymorphonuclear cells, by causing cell rupture. The leukotoxin binds to the host LFA-1 integrin and induces a signaling cascade leading to many biological effects, including tyrosine phosphorylation of the CD18 tail, elevation of the intracellular Ca (2+) and lysis of the host cell (By similarity) . This leukotoxin is a major contributor to the pathogenesis of lung injury in ovine pneumonic pasteurellosis. It has also weak hemolytic activity.

• Molecular Weight:

  28 kDa

• References & Citations:

  Sequence diversity and molecular evolution of the leukotoxin (lktA) gene in bovine and ovine strains of Mannheimia (Pasteurella) haemolytica.Davies R.L., Whittam T.S., Selander R.K.J. Bacteriol. 183:1394-1404 (2001)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial