Recombinant Rat RegeneRating islet-derived protein 3-gamma (Reg3g)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Rat RegeneRating islet-derived protein 3-gamma (Reg3g)
Product Name Alternative:
Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ; Reg III-gamma
Abbreviation:
Recombinant Rat Reg3g protein
Gene Name:
Reg3g
UniProt:
P42854
Expression Region:
27-174aa
Organism:
Rattus norvegicus (Rat)
Target Sequence:
EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA
Tag:
N-terminal 6xHis-tagged
Type:
Developed Protein
Source:
Yeast
Field of Research:
Others
Relevance:
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury .
Endotoxin:
Not test
Purity:
Greater than 90% as determined by SDS-PAGE.
Activity:
Not Test
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function:
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury (By similarity) .
Molecular Weight:
18.3 kDa
References & Citations:
Reg3G gene expression in regenerating skeletal muscle and corresponding nerve.Klasan G.S., Ivanac D., Erzen D.J., Picard A., Takasawa S., Peharec S., Arbanas J., Girotto D., Jerkovic R.Muscle Nerve 49:61-68 (2014)
Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length:
Full Length of Mature Protein