Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5 (LILRA5), partial

• Product Name Alternative:

  CD85 antigen-like family member FImmunoglobulin-like transcript 11 ; ILT-11Leukocyte immunoglobulin-like receptor 9 ; LIR-9; CD85f

• Abbreviation:

  Recombinant Human LILRA5 protein, partial

• Gene Name:

  LILRA5

• UniProt:

  A6NI73

• Expression Region:

  42-268aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  Yeast

• Field of Research:

  Immunology

• Relevance:

  May play a role in triggering innate immune responses. Does not se to play a role for any class I MHC antigen recognition.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

• Molecular Weight:

  27.2 kDa

• References & Citations:

  Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster.Wende H., Volz A., Ziegler A.Immunogenetics 51:703-713 (2000)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Extracellular Domain