Recombinant Mouse Integrin alpha-L (Itgal), partial

• Product Name Alternative:

  CD11 antigen-like family member ALeukocyte adhesion glycoprotein LFA-1 alpha chain ; LFA-1ALeukocyte function-associated molecule 1 alpha chain; Lymphocyte antigen 15 ; Ly-15; CD11a

• Abbreviation:

  Recombinant Mouse Itgal protein, partial

• Gene Name:

  Itgal

• UniProt:

  P24063

• Expression Region:

  153-325aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  Yeast

• Field of Research:

  Others

• Relevance:

  Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene donstrate impaired tumor rejection and impaired leukocytes recruitment.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4

• Molecular Weight:

  21.7 kDa

• References & Citations:

  Cloning of the murine lymphocyte function-associated molecule-1 alpha-subunit and its expression in COS cells.Kaufmann Y., Tseng E., Springer T.A.J. Immunol. 147:369-374 (1991)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial